Catalog No.
SHK08301
Species
Human
Protein length
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Nature
Synthetic peptide
Purity
>90% as determined by HPLC.
Accession
P05067
Form
Lyophilized
Reconstitution
Reconstitute in sterile water for a stock solution. A copy of datasheet will be provided with the products, please refer to it for details.
Shipping
In general, proteins are provided as lyophilized powder/frozen liquid. They are shipped out with dry ice/blue ice unless customers require otherwise.
Stability and Storage
Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8°C for one week. Store at -20 to -80°C for twelve months from the date of receipt.
Alternative Names
Aβ 1-40, β-Amyloid (1-40) Peptide, Abeta40, Beta-APP40, Amyloid-beta protein 40, amyloid beta A4 precursor protein, Amyloid-beta A4 protein
Potential role of Amyloid-β on the association between Orexin-A and blood-brain barrier leakage of globus pallidus in Alzheimer's disease and dementia with lewy bodies., PMID:40457423
Neuroprotective Effects of Tectoridin in H2O2-Induced Oxidative Stress and an Amyloid-Infused Rat Model of Alzheimer's Disease., PMID:40455354
GAL-201 as a Promising Amyloid-β-Targeting Small-Molecule Approach for Alzheimer's Disease Treatment: Consistent Effects on Synaptic Plasticity, Behavior and Neuroinflammation., PMID:40362405
Method comparison and re-calibration of three top-used immunoassays and one LC-MS/MS assay for four core cerebrospinal fluid biomarkers of Alzheimer's disease: an explorative study for harmonization., PMID:40360016
Chemical imaging delineates Aβ plaque polymorphism across the Alzheimer's disease spectrum., PMID:40274785
Associations of choroid plexus volume with white matter hyperintensity volume and susceptibility and plasma amyloid markers in cerebral small vessel disease., PMID:40270041
Investigation of PANoptosis pathway in age-related macular degeneration triggered by Aβ1-40., PMID:40251333
Characterization of pH-Dependent Reversible Self-Assembly of Amyloid Beta 1-40-Coated Gold Colloids., PMID:40193301
Amyloid β1-40 Predicts Long-Term Mortality Rate in Patients With Acute Myocardial Infarction., PMID:40178097
Potential of facial biomarkers for Alzheimer's disease and obstructive sleep apnea in Down syndrome and general population., PMID:40123509
L1CAM mimetic compound duloxetine improves cognitive impairment in 5xFAD mice and protects Aβ1-42-damaged HT22 cells., PMID:40057157
Diagnostic and Prognostic Biomarkers of Idiopathic Normal Pressure Hydrocephalus in Cerebrospinal Fluid and Blood., PMID:40054974
Selenium- and zinc-biofortified bean sprouts improve cognitive dysfunction in aging mice by reducing oxidative stress., PMID:40052503
Circulating amyloid beta 1-40 peptide as an associate of renal function decline., PMID:39989380
Enhanced Alzheimer's biomarker detection using a ternary composite electrochemical aptasensor., PMID:39955684
Beneficial effects of the herbal medicine zuo gui wan in a mice model of Alzheimer's disease via Drp1-Mediated inhibition of mitochondrial fission and activation of AMPK/PGC-1α-regulated mitochondrial bioenergetics., PMID:39884486
Programmable short peptides for modulating stem cell fate in tissue engineering and regenerative medicine., PMID:39871657
Efficient Seeding of Cerebral Vascular Aβ-Amyloidosis by Recombinant AβM1-42 Amyloid Fibrils., PMID:39725269
A comparison of cognitive decline in aged mice and mice treated with aftin-4., PMID:39550500
Acorus tatarinowii alleviates D-galactose-induced Alzheimer's-like disease cognitive impairment and Aβ-induced pericytes dysfunction in mice., PMID:39515743
Metabolic resistance of Aβ3pE-42, a target epitope of the anti-Alzheimer therapeutic antibody, donanemab., PMID:39348937
Noise Exposure Promotes Alzheimer's Disease-Like Lesions and DNA Damage., PMID:39345066
Understanding Osaka mutation polymorphic Aβ fibril response to static and oscillating electric fields: insights from computational modeling., PMID:39333193
Gene-variant specific effects of plasma amyloid-β levels in Swedish autosomal dominant Alzheimer disease., PMID:39322953
[Suppression effect of secoisolariciresinol diglucoside against trans fatty acids-induced oxidative damage and inflammatory in brain of offspring mice]., PMID:39308109
Blood-brain barrier breakdown in dementia with Lewy bodies., PMID:39289698
A streamlined, resource-efficient immunoprecipitation-mass spectrometry method for quantifying plasma amyloid-β biomarkers in Alzheimer's disease., PMID:39281858
Plasma NfL, GFAP, amyloid, and p-tau species as Prognostic biomarkers in Parkinson's disease., PMID:39249107
Biomarker changes in suspected idiopathic normal-pressure hydrocephalus patients undergoing external lumbar drainage: a pilot study., PMID:39219196
Cellular prion protein acts as mediator of amyloid beta uptake by caveolin-1 causing cellular dysfunctions in vitro and in vivo., PMID:39212313
Enhanced Brain Clearance of Tau and Amyloid-β in Alzheimer's Disease Patients by Transcranial Radiofrequency Wave Treatment: A Central Role of Vascular Endothelial Growth Factor (VEGF)., PMID:39177605
Amyloid beta 1-40 and 1-42 fibril ratios and maturation level cause conformational differences with minimal impact on autophagy and cytotoxicity., PMID:39133499
House dust mite-induced asthma exacerbates Alzheimer's disease changes in the brain of the AppNL-G-F mouse model of disease., PMID:39084541
Oligomer Formation by Physiologically Relevant C-Terminal Isoforms of Amyloid β-Protein., PMID:39062488
Unraveling the relationship among insulin resistance, IGF-1, and amyloid-beta 1-40: Is the definition of type 3 diabetes applicable in the cardiovascular field?, PMID:39002609
Deubiquitinating Enzyme USP19 Regulates Ferroptosis and Mitochondrial Damage in SH-SY5Y Cells by Targeting the NOX4 Protein., PMID:38943386
Electropositive Citric Acid-Polyethyleneimine Carbon Dots Carrying the PINK1 Gene Regulate ATP-Related Metabolic Dysfunction in APP/PS1-N2a Cells., PMID:38731398
Acute Hyperglycemia Induced by Hyperglycemic Clamp Affects Plasma Amyloid-β in Type 2 Diabetes., PMID:38728183
Antibody engagement with amyloid-beta does not inhibit [11C]PiB binding for PET imaging., PMID:38721627
Characterizing the Oligomers Distribution along the Aggregation Pathway of Amyloid Aβ1-40 by NMR., PMID:38712990
Assessment of Preanalytical Cerebrospinal Fluid Handling and Storage Factors on Measurement of Aβ1-42, Aβ1-40, and pTau181 Using an Automated Chemiluminescent Platform., PMID:38712812
Interactions between Beta-Amyloid and Pericytes in Alzheimer's Disease., PMID:38682184
Palmatine improves cognitive dysfunction in Alzheimer's disease model rats through autophagy pathway and regulation of gut microbiota., PMID:38609032
Total ginsenosides decrease Aβ production through activating PPARγ., PMID:38593704
In Vitro Astroglial Dysfunction Induced by Neurotoxins: Mimicking Astrocytic Metabolic Alterations of Alzheimer's Disease., PMID:38535311
Where Should I Draw the Line: PET-Driven, Data-Driven, or Manufacturer Cut-Off?, PMID:38489172
Metabolites of intestinal fora can be used as diagnostic and progressive markers for mild cognitive impairment., PMID:38404286
Neuronal pentraxin 2 correlates with neurodegeneration but not cognition in idiopathic normal pressure hydrocephalus (iNPH)., PMID:38393959
Targeting blood brain barrier-Remote ischemic conditioning alleviates cognitive impairment in female APP/PS1 rats., PMID:38379185
An LC-MS/MS-based platform for the quantification of multiple amyloid beta peptides in surrogate cerebrospinal fluid., PMID:38375485
For research use only. Not for human or drug use.
