Please ensure Javascript is enabled for purposes of website accessibility
Home / Products / Recombinant Protein / Other Proteins

Glucagon-like peptide 1/GLP-1 Peptide

Catalog #:   SHB93501 Specific References (50) DATASHEET
Applications: ELISA, Immunogen, WB
Accession: P01275
Protein length: GLP-1 Peptide (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG).
Overview

Catalog No.

SHB93501

Species

Human

Protein length

GLP-1 Peptide (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG).

Predicted molecular weight

3.36 kDa

Endotoxin level

Please contact with the lab for this information.

Purity

>90% as determined by HPLC.

Accession

P01275

Applications

ELISA, Immunogen, WB

Form

Lyophilized

Storage buffer

Lyophilized from a solution in PBS pH 7.4, 4% Trehalose, 1% Mannitol.

Reconstitution

Reconstitute in sterile water for a stock solution. A copy of datasheet will be provided with the products, please refer to it for details.

Shipping

In general, proteins are provided as lyophilized powder/frozen liquid. They are shipped out with dry ice/blue ice unless customers require otherwise.

Stability and Storage

Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8°C for one week. Store at -20 to -80°C for twelve months from the date of receipt.

Alternative Names

GLP-1(7-36), Incretin hormone, GLP-2, GCG, GLP-1(7-37), OXM, Pro-glucagon, GLP-1, GRPP, OXY

Data Image
References

Interconnected pathways and emerging therapies in chronic kidney disease and heart failure: A comprehensive review., PMID:40533425

Comparative outcomes of adding SGLT2 inhibitors versus incretin-based therapies to insulin in type 2 diabetes., PMID:40532767

GLP-1 (Glucagon-Like Peptide-1): Its Effects on Obesity and Type 2 Diabetes., PMID:40532087

Dissociation of plasma oxyntomodulin levels from anthropometric measures and metabolic markers in women with polycystic ovary syndrome., PMID:40532052

Hypophagia and body weight loss by tirzepatide are accompanied by fewer GI adverse events compared to semaglutide in preclinical models., PMID:40532005

Oral delivery of GLP-1 peptide using recombinant Lactobacillus gasseri for the treatment of type 2 diabetes mellitus., PMID:40530879

The Role of the Dietitian in Weight Management of Adults With Obesity Without Diabetes Using Glucagon Like Peptide-1 Agonist Receptors: A Systematic Review and Meta-Analysis of Randomised Controlled Clinical Trials., PMID:40530685

CURRENT TREATMENT APPROACHES AND GLYCEMIC CONTROL IN TURKISH PATIENTS WITH TYPE 2 DIABETES MELLITUS: A REAL-WORLD EVIDENCE FROM A TERTIARY HOSPITAL IN TURKEY., PMID:40530092

Finerenone in diabetic kidney disease: a new frontier for slowing disease progression., PMID:40529138

A nitroalkene derivative of salicylate, SANA, induces creatine-dependent thermogenesis and promotes weight loss., PMID:40527924

Efficacy and safety of GLP1-ras compared to SGLT2is and DPP-4is in individuals with schizophrenia and diabetes: A Danish nationwide target-trial emulation study., PMID:40526989

Discovery of peptides as key regulators of metabolic and cardiovascular crosstalk., PMID:40526470

β-cell Gɑs signaling is critical for physiological and pharmacological enhancement of insulin secretion., PMID:40526441

GLP-1 Receptor Agonist Outcomes, Safety, and BMI Change in a National Cohort of Dialysis Patients., PMID:40526425

Liraglutide improves depressive and cognitive deficits in a high-fat diet rat model of obesity: the role of hippocampal autophagy and the PI3K/Akt/mTOR pathway., PMID:40526304

Effectiveness and tolerability of liraglutide as add-on treatment in patients with obesity and high-frequency or chronic migraine: A prospective pilot study., PMID:40525593

Comparative Effectiveness of Sodium-Glucose Cotransporter-2 Inhibitors Versus Glucagon-Like Peptide-1 Receptor Agonists in Reducing Cardiovascular Events in Patients With Type 2 Diabetes., PMID:40524985

Gestational saccharin consumption disrupts gut-brain axis glucose homeostasis control in adolescent offspring rats in a sex-dependent manner., PMID:40524248

Comparison of Semaglutide or Dulaglutide Versus Empagliflozin for Risk for Death and Cardiovascular Outcomes Among Patients With Type 2 Diabetes : Two Target Trial Emulation Studies., PMID:40523289

68Ga-Exendin-4 PET/CT Enables Identification of Multiple and Ectopic Insulinoma in a Patient With Multiple Endocrine Neoplasia 1., PMID:40523237

Salacia Reticulata Extract Improves Insulin Sensitivity and Glucose Homeostasis by Activating Insulin Signaling and Glucagon-like Peptide-1 Modulation., PMID:40523228

The engineered probiotic strain Lactococcus lactis MG1363-pMG36e-GLP-1 regulates microglial polarization and gut dysbiosis in a transgenic mouse model of Parkinson's disease., PMID:40522767

Psychiatric adverse events linked to glucagon-like peptide 1 analogues: a disproportionality analysis in American, Canadian and Australian adverse event databases., PMID:40522403

'This Is My Decision': A Qualitative Study of Individuals' Perspectives on Use of Semaglutide for Weight Loss., PMID:40521912

Therapeutic Targeting of the GIP Receptor-Revisiting the Controversies., PMID:40521880

GIP Receptor Antagonists in the Pharmacotherapy of Obesity: Physiologic, Genetic, and Clinical Rationale., PMID:40521869

Update on the pathophysiology and treatment of diabetic kidney disease: a narrative review., PMID:40521811

Why do patients with obesity discontinue glucagon-like peptide 1 analogues?, PMID:40521761

Hormonal adaptations to weight loss: Responses to an oral glucose load 4 weeks after obesity surgery and low-energy diet., PMID:40521749

GLP-1R in diabetes mellitus: from basic discovery to therapeutics development., PMID:40520185

How to Enhance Cardiorenal Benefits in Patients With Chronic Heart Failure?, PMID:40519717

When Two Worlds Collide: Navigating Diabetes in Cystic Fibrosis., PMID:40519490

Should GLP-1 receptor agonist therapy be used to treat obesity in Bardet-Biedl syndrome?, PMID:40519161

[Guidelines for the basic management of chronic kidney disease]., PMID:40518893

Efficacy and safety of once-daily oral semaglutide in patients with heart failure with preserved ejection fraction, type 2 diabetes and obesity: a real-world study., PMID:40518344

Tirzepatide, a dual GIP/GLP1-receptor co-agonist preserves cardiac function and improves survival in angiotensin II-induced heart failure model in mice: comparison to liraglutide., PMID:40517248

Progress and challenges in obesity pharmacotherapy: semaglutide as a milestone., PMID:40515833

Intranasal Absorption Enhancement of Antidiabetic Therapeuticals by the Functional Peptide Segment of Latroeggtoxin-VI., PMID:40515721

Interleukin-1β in circulating mononuclear cells predicts steatotic liver disease improvement after weight loss in subjects with obesity and prediabetes or type 2 diabetes., PMID:40514652

[Weight reduction with incretin mimetics-Opportunities and risks]., PMID:40514554

[Bariatric surgery versus GLP-1 and dual GIP/GLP-1 receptor agonists : Effects on weight, risk factors and prognosis]., PMID:40514456

The management of hypothalamic obesity in craniopharyngioma., PMID:40514321

Glucagon-like Peptide-1 Receptor Agonist Use in Patients with Psoriasis is Associated with Lower Incidence of Atherosclerotic Cardiovascular Disease: A Retrospective Cohort Study Using TriNetX., PMID:40513888

Designing structure-specific and switchable allosteric effectors for GPCRs based on the causality and energetics of inherent signaling., PMID:40513649

High-dimensional Iterative Causal Forest (hdiCF) for Subgroup Identification Using Health Care Claims Data., PMID:40512658

Exploring the role of glucagon-like peptide-1 receptor agonists in critical illness: mechanisms, benefits, and clinical implications., PMID:40512576

Kidney Parameters with Tirzepatide in Obesity with or without Type 2 Diabetes., PMID:40512543

Type 2 Diabetes Mellitus Remission, Dream or Reality? A Narrative Review of Current Evidence and Integrated Care Strategies., PMID:40512404

Glucagon-like peptide-1 receptor agonist therapy in patients with type 2 diabetes and advanced CKD: kidney and cardiovascular outcomes in a real-world setting., PMID:40510690

Efficacy and safety of finerenone in obesity-related glomerulopathy., PMID:40510688

Datasheet
$ 600
Product specifications
5 mg 600

Contact Information

Order: order@antibodysystem.com

Mail: support@antibodysystem.com

Distributor list

For research use only. Not for human or drug use.

Need help with your order?

Find out more about placing an order here

Glucagon-like peptide 1/GLP-1 Peptide [SHB93501]
Terms of sale Website terms of use Cookie policy Privacy
Copyright © 2025 AntibodySystem SAS. All Rights Reserved.            All Products are for Research Use Only