Catalog No.
SHB93501
Species
Human
Protein length
GLP-1 Peptide (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG).
Predicted molecular weight
3.36 kDa
Endotoxin level
Please contact with the lab for this information.
Purity
>90% as determined by HPLC.
Accession
P01275
Applications
ELISA, Immunogen, WB
Form
Lyophilized
Storage buffer
Lyophilized from a solution in PBS pH 7.4, 4% Trehalose, 1% Mannitol.
Reconstitution
Reconstitute in sterile water for a stock solution. A copy of datasheet will be provided with the products, please refer to it for details.
Shipping
In general, proteins are provided as lyophilized powder/frozen liquid. They are shipped out with dry ice/blue ice unless customers require otherwise.
Stability and Storage
Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8°C for one week. Store at -20 to -80°C for twelve months from the date of receipt.
Alternative Names
GLP-1(7-36), Incretin hormone, GLP-2, GCG, GLP-1(7-37), OXM, Pro-glucagon, GLP-1, GRPP, OXY
Interconnected pathways and emerging therapies in chronic kidney disease and heart failure: A comprehensive review., PMID:40533425
Comparative outcomes of adding SGLT2 inhibitors versus incretin-based therapies to insulin in type 2 diabetes., PMID:40532767
GLP-1 (Glucagon-Like Peptide-1): Its Effects on Obesity and Type 2 Diabetes., PMID:40532087
Dissociation of plasma oxyntomodulin levels from anthropometric measures and metabolic markers in women with polycystic ovary syndrome., PMID:40532052
Hypophagia and body weight loss by tirzepatide are accompanied by fewer GI adverse events compared to semaglutide in preclinical models., PMID:40532005
Oral delivery of GLP-1 peptide using recombinant Lactobacillus gasseri for the treatment of type 2 diabetes mellitus., PMID:40530879
The Role of the Dietitian in Weight Management of Adults With Obesity Without Diabetes Using Glucagon Like Peptide-1 Agonist Receptors: A Systematic Review and Meta-Analysis of Randomised Controlled Clinical Trials., PMID:40530685
CURRENT TREATMENT APPROACHES AND GLYCEMIC CONTROL IN TURKISH PATIENTS WITH TYPE 2 DIABETES MELLITUS: A REAL-WORLD EVIDENCE FROM A TERTIARY HOSPITAL IN TURKEY., PMID:40530092
Finerenone in diabetic kidney disease: a new frontier for slowing disease progression., PMID:40529138
A nitroalkene derivative of salicylate, SANA, induces creatine-dependent thermogenesis and promotes weight loss., PMID:40527924
Efficacy and safety of GLP1-ras compared to SGLT2is and DPP-4is in individuals with schizophrenia and diabetes: A Danish nationwide target-trial emulation study., PMID:40526989
Discovery of peptides as key regulators of metabolic and cardiovascular crosstalk., PMID:40526470
β-cell Gɑs signaling is critical for physiological and pharmacological enhancement of insulin secretion., PMID:40526441
GLP-1 Receptor Agonist Outcomes, Safety, and BMI Change in a National Cohort of Dialysis Patients., PMID:40526425
Liraglutide improves depressive and cognitive deficits in a high-fat diet rat model of obesity: the role of hippocampal autophagy and the PI3K/Akt/mTOR pathway., PMID:40526304
Effectiveness and tolerability of liraglutide as add-on treatment in patients with obesity and high-frequency or chronic migraine: A prospective pilot study., PMID:40525593
Comparative Effectiveness of Sodium-Glucose Cotransporter-2 Inhibitors Versus Glucagon-Like Peptide-1 Receptor Agonists in Reducing Cardiovascular Events in Patients With Type 2 Diabetes., PMID:40524985
Gestational saccharin consumption disrupts gut-brain axis glucose homeostasis control in adolescent offspring rats in a sex-dependent manner., PMID:40524248
Comparison of Semaglutide or Dulaglutide Versus Empagliflozin for Risk for Death and Cardiovascular Outcomes Among Patients With Type 2 Diabetes : Two Target Trial Emulation Studies., PMID:40523289
68Ga-Exendin-4 PET/CT Enables Identification of Multiple and Ectopic Insulinoma in a Patient With Multiple Endocrine Neoplasia 1., PMID:40523237
Salacia Reticulata Extract Improves Insulin Sensitivity and Glucose Homeostasis by Activating Insulin Signaling and Glucagon-like Peptide-1 Modulation., PMID:40523228
The engineered probiotic strain Lactococcus lactis MG1363-pMG36e-GLP-1 regulates microglial polarization and gut dysbiosis in a transgenic mouse model of Parkinson's disease., PMID:40522767
Psychiatric adverse events linked to glucagon-like peptide 1 analogues: a disproportionality analysis in American, Canadian and Australian adverse event databases., PMID:40522403
'This Is My Decision': A Qualitative Study of Individuals' Perspectives on Use of Semaglutide for Weight Loss., PMID:40521912
Therapeutic Targeting of the GIP Receptor-Revisiting the Controversies., PMID:40521880
GIP Receptor Antagonists in the Pharmacotherapy of Obesity: Physiologic, Genetic, and Clinical Rationale., PMID:40521869
Update on the pathophysiology and treatment of diabetic kidney disease: a narrative review., PMID:40521811
Why do patients with obesity discontinue glucagon-like peptide 1 analogues?, PMID:40521761
Hormonal adaptations to weight loss: Responses to an oral glucose load 4 weeks after obesity surgery and low-energy diet., PMID:40521749
GLP-1R in diabetes mellitus: from basic discovery to therapeutics development., PMID:40520185
How to Enhance Cardiorenal Benefits in Patients With Chronic Heart Failure?, PMID:40519717
When Two Worlds Collide: Navigating Diabetes in Cystic Fibrosis., PMID:40519490
Should GLP-1 receptor agonist therapy be used to treat obesity in Bardet-Biedl syndrome?, PMID:40519161
[Guidelines for the basic management of chronic kidney disease]., PMID:40518893
Efficacy and safety of once-daily oral semaglutide in patients with heart failure with preserved ejection fraction, type 2 diabetes and obesity: a real-world study., PMID:40518344
Tirzepatide, a dual GIP/GLP1-receptor co-agonist preserves cardiac function and improves survival in angiotensin II-induced heart failure model in mice: comparison to liraglutide., PMID:40517248
Progress and challenges in obesity pharmacotherapy: semaglutide as a milestone., PMID:40515833
Intranasal Absorption Enhancement of Antidiabetic Therapeuticals by the Functional Peptide Segment of Latroeggtoxin-VI., PMID:40515721
Interleukin-1β in circulating mononuclear cells predicts steatotic liver disease improvement after weight loss in subjects with obesity and prediabetes or type 2 diabetes., PMID:40514652
[Weight reduction with incretin mimetics-Opportunities and risks]., PMID:40514554
[Bariatric surgery versus GLP-1 and dual GIP/GLP-1 receptor agonists : Effects on weight, risk factors and prognosis]., PMID:40514456
The management of hypothalamic obesity in craniopharyngioma., PMID:40514321
Glucagon-like Peptide-1 Receptor Agonist Use in Patients with Psoriasis is Associated with Lower Incidence of Atherosclerotic Cardiovascular Disease: A Retrospective Cohort Study Using TriNetX., PMID:40513888
Designing structure-specific and switchable allosteric effectors for GPCRs based on the causality and energetics of inherent signaling., PMID:40513649
High-dimensional Iterative Causal Forest (hdiCF) for Subgroup Identification Using Health Care Claims Data., PMID:40512658
Exploring the role of glucagon-like peptide-1 receptor agonists in critical illness: mechanisms, benefits, and clinical implications., PMID:40512576
Kidney Parameters with Tirzepatide in Obesity with or without Type 2 Diabetes., PMID:40512543
Type 2 Diabetes Mellitus Remission, Dream or Reality? A Narrative Review of Current Evidence and Integrated Care Strategies., PMID:40512404
Glucagon-like peptide-1 receptor agonist therapy in patients with type 2 diabetes and advanced CKD: kidney and cardiovascular outcomes in a real-world setting., PMID:40510690
Efficacy and safety of finerenone in obesity-related glomerulopathy., PMID:40510688