Aβ1-34/β-Amyloid (1-34) Peptide, Human

Catalog No.

SHC12501

Species

Human

Protein length

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

Nature

Synthetic peptide

Purity

>90% as determined by HPLC.

Accession

P05067

Form

Lyophilized

Reconstitution

Reconstitute in sterile water for a stock solution. A copy of datasheet will be provided with the products, please refer to it for details.

Shipping

In general, proteins are provided as lyophilized powder/frozen liquid. They are shipped out with dry ice/blue ice unless customers require otherwise.

Stability and Storage

Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8°C for one week. Store at -20 to -80°C for twelve months from the date of receipt.

Alternative Names

Aβ 1-34, β-Amyloid (1-34) Peptide, Abeta34, Beta-APP34, Amyloid-beta protein 34, amyloid beta A4 precursor protein, Amyloid-beta A4 protein

Patient-specific Alzheimer-like pathology in trisomy 21 cerebral organoids reveals BACE2 as a gene dose-sensitive AD suppressor in human brain., PMID:32647257

β-site amyloid precursor protein-cleaving enzyme 1(BACE1) inhibitor treatment induces Aβ5-X peptides through alternative amyloid precursor protein cleavage., PMID:25404952

Study on Aβ34 biology and detection in transgenic mice brains., PMID:24495834

Identification of β-amyloid species in canine cerebrospinal fluid by mass spectrometry., PMID:23582658

BACE1 inhibition induces a specific cerebrospinal fluid β-amyloid pattern that identifies drug effects in the central nervous system., PMID:22328928

Cerebrospinal fluid profile of amyloid beta peptides in patients with Alzheimer's disease determined by protein biochip technology., PMID:16908995

The functional gamma-secretase inhibitor prevents production of amyloid beta 1-34 in human and murine cell lines., PMID:11716984

Document Download

Aβ1-34/β-Amyloid (1-34) Peptide, Human.pdf